Lineage for d5b66x_ (5b66 x:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227482Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2227483Family f.23.40.1: PsbX-like [267615] (2 protein domains)
  6. 2227487Protein automated matches [267680] (2 species)
    not a true protein
  7. 2227492Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (10 PDB entries)
  8. 2287005Domain d5b66x_: 5b66 x: [330306]
    Other proteins in same PDB: d5b66d_, d5b66e_, d5b66f_, d5b66l_, d5b66m_, d5b66o_, d5b66t_
    automated match to d4il6x_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66x_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (x:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d5b66x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66x_ f.23.40.1 (x:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidk

SCOPe Domain Coordinates for d5b66x_:

Click to download the PDB-style file with coordinates for d5b66x_.
(The format of our PDB-style files is described here.)

Timeline for d5b66x_:

  • d5b66x_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23