![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) ![]() Pfam PF06596 |
![]() | Family f.23.40.1: PsbX-like [267615] (2 proteins) |
![]() | Protein automated matches [267680] (2 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries) |
![]() | Domain d5b66x_: 5b66 x: [330306] Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66z_ automated match to d4il6x_ complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b66 (more details), 1.85 Å
SCOPe Domain Sequences for d5b66x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b66x_ f.23.40.1 (x:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} titpslkgffigllsgavvlgltfavliaisqidk
Timeline for d5b66x_: