![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
![]() | Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) ![]() automatically mapped to Pfam PF00906 |
![]() | Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
![]() | Protein automated matches [191131] (3 species) not a true protein |
![]() | Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries) |
![]() | Domain d5t2pd1: 5t2p D:1-149 [330198] Other proteins in same PDB: d5t2pb2, d5t2pd2 automated match to d4bmga_ complexed with cl, dms, gol, ipa, k89; mutant |
PDB Entry: 5t2p (more details), 1.69 Å
SCOPe Domain Sequences for d5t2pd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t2pd1 a.62.1.1 (D:1-149) automated matches {Hepatitis B virus [TaxId: 10407]} mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv sfgvwirtppaarppnapilstlpettvv
Timeline for d5t2pd1: