SCOP 1.57: Domain d2fhea2: 2fhe A:1-80

Lineage for d2fhea2 (2fhe A:1-80)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Fasciola hepatica [TaxId:6192] [52879] (2 PDB entries)

8. Domain d2fhea2: 2fhe A:1-80 [33018]
   Other proteins in same PDB: d2fhea1, d2fheb1

Details for d2fhea2

PDB Entry: 2fhe, 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione

SCOP Domain Sequences for d2fhea2:

Sequence; same for both SEQRES and ATOM records:

>d2fhea2 c.47.1.5 (A:1-80) Glutathione S-transferase {Fasciola hepatica}
paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd
kckltqslailryiadkhgm

Timeline for d2fhea2:

• d2fhea2 first appeared (with stable ids) in SCOP 1.55
  
• d2fhea2 appears in SCOP 1.59
  
• d2fhea2 appears in the current release, SCOPe 2.08