SCOPe 2.07: Domain d5tlka2: 5tlk A:111-215

Lineage for d5tlka2 (5tlk A:111-215)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
Domain d5tlka2: 5tlk A:111-215 [329641]
Other proteins in same PDB: d5tlka1, d5tlkc1, d5tlke1, d5tlkg1
automated match to d1dn0a2
complexed with nag

Details for d5tlka2

PDB Entry: 5tlk (more details), 2.7 Å

PDB Description: complex between human cd27 and fab fragments of antibodies m2177 and h2191

PDB Compounds: (A:) m2177 light chain

SCOPe Domain Sequences for d5tlka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tlka2 b.1.1.2 (A:111-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d5tlka2:

Click to download the PDB-style file with coordinates for d5tlka2.
(The format of our PDB-style files is described here.)

Timeline for d5tlka2: