SCOPe 2.07: Domain d5m1ab2: 5m1a B:139-327

Lineage for d5m1ab2 (5m1a B:139-327)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   the insert subdomain (residues 168-239) is fully ordered

7. Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
   Uniprot O54286 27-668

8. Domain d5m1ab2: 5m1a B:139-327 [329574]
   Other proteins in same PDB: d5m1aa1, d5m1aa3, d5m1ab1, d5m1ab3
   automated match to d1vqqa2
   complexed with cd, mur

Details for d5m1ab2

PDB Entry: 5m1a, 2 Å

PDB Description: crystal structure of pbp2a from mrsa in the presence of ceftazidime ligand

PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5m1ab2:

Sequence; same for both SEQRES and ATOM records:

>d5m1ab2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d5m1ab2:

• d5m1ab2 first appeared in SCOPe 2.06
  
• d5m1ab2 appears in the current release, SCOPe 2.08