SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gt2d_ (5gt2 D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173213Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2173214Protein automated matches [190081] (25 species)
    not a true protein
  7. 2286120Species Escherichia coli [TaxId:83333] [329421] (1 PDB entry)
  8. 2286184Domain d5gt2d_: 5gt2 D: [329485]
    automated match to d2iiza_
    complexed with hem

Details for d5gt2d_

PDB Entry: 5gt2 (more details), 2.09 Å

PDB Description: crystal structure and biochemical features of dye-decolorizing peroxidase yfex from escherichia coli o157
PDB Compounds: (D:) Probable deferrochelatase/peroxidase YfeX

SCOPe Domain Sequences for d5gt2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gt2d_ d.58.4.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
qvqsgilpehcraaiwieanvkgevdalraasktfadklatfeakfpdahlgavvafgnn
twralsggvgaeelkdfpgygkglapttqfdvlihilslrhdvnfsvaqaameafgdcie
vkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnlkq
lnrmsvhdqemmigrtkeaneeidgderpetshltrvdlkedgkglkivrqslpygtasg
thglyfcaycarlhnieqqllsmfgdtdgkrdamlrftkpvtggyyfapsldklma

SCOPe Domain Coordinates for d5gt2d_:

Click to download the PDB-style file with coordinates for d5gt2d_.
(The format of our PDB-style files is described here.)

Timeline for d5gt2d_:

  • d5gt2d_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08