Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
Protein automated matches [190245] (11 species) not a true protein |
Species Thermotoga neapolitana [TaxId:2337] [329442] (1 PDB entry) |
Domain d5idib_: 5idi B: [329451] automated match to d1oima_ complexed with act; mutant |
PDB Entry: 5idi (more details), 1.9 Å
SCOPe Domain Sequences for d5idib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5idib_ c.1.8.4 (B:) automated matches {Thermotoga neapolitana [TaxId: 2337]} mkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk edieiiekigakayrfsiswprilpegtgkvnqkgldfynriidtlleknitpfitiyhw dlpfslqlkggwanrdiadwfaeysrvlfenfgdrvkhwitlnelwvvaivghlygvhap gmkdiyvafhtvhnllrahaksvkvfretvkdgkigivfnngyfepasereediraarfm hqfnnyplflnpiyrgeypdlvlefareylprnyeddmeeikqeidfvglnyysghmvky dpnsparvsfvernlpktamgweivpegiywilkgvkeeynpqevyitgngaafddvvse ggkvhdqnridylrahieqvwraiqdgvplkgyfvwslldnfewaegyskrfgivyvdyn tqkriikdsgywysnviknngltd
Timeline for d5idib_: