SCOPe 2.08: Domain d5gt2b_: 5gt2 B:

Lineage for d5gt2b_ (5gt2 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [329421] (1 PDB entry)

8. Domain d5gt2b_: 5gt2 B: [329422]
   automated match to d2iiza_
   complexed with hem

Details for d5gt2b_

PDB Entry: 5gt2, 2.09 Å

PDB Description: crystal structure and biochemical features of dye-decolorizing peroxidase yfex from escherichia coli o157

PDB Compounds: (B:) Probable deferrochelatase/peroxidase YfeX

SCOPe Domain Sequences for d5gt2b_:

Sequence; same for both SEQRES and ATOM records:

>d5gt2b_ d.58.4.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
qvqsgilpehcraaiwieanvkgevdalraasktfadklatfeakfpdahlgavvafgnn
twralsggvgaeelkdfpgygkglapttqfdvlihilslrhdvnfsvaqaameafgdcie
vkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnlkq
lnrmsvhdqemmigrtkeaneeidgderpetshltrvdlkedgkglkivrqslpygtasg
thglyfcaycarlhnieqqllsmfgdtdgkrdamlrftkpvtggyyfapsldklma

Timeline for d5gt2b_:

• d5gt2b_ first appeared in SCOPe 2.06
  
• d5gt2b_ appears in SCOPe 2.07