Lineage for d5b66i_ (5b66 i:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026703Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 3026704Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 3026705Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 3026719Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries)
  8. 3026720Domain d5b66i_: 5b66 i: [329395]
    Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66j_, d5b66k_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_, d5b66z_
    automated match to d4ub8i_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66i_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (i:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5b66i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66i_ f.23.37.1 (i:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkd

SCOPe Domain Coordinates for d5b66i_:

Click to download the PDB-style file with coordinates for d5b66i_.
(The format of our PDB-style files is described here.)

Timeline for d5b66i_: