SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b66k_ (5b66 K:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227418Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2227419Family f.23.36.1: PsbK-like [161038] (1 protein)
    Pfam PF02533
  6. 2227420Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 2227425Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (9 PDB entries)
  8. 2286088Domain d5b66k_: 5b66 K: [329389]
    Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66h_, d5b66i_, d5b66j_, d5b66u_, d5b66v_, d5b66z_
    automated match to d2axtk1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66k_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5b66k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66k_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d5b66k_:

Click to download the PDB-style file with coordinates for d5b66k_.
(The format of our PDB-style files is described here.)

Timeline for d5b66k_:

  • d5b66k_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-03