![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
![]() | Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
![]() | Protein Photosystem II reaction center protein K, PsbK [161039] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries) |
![]() | Domain d5b66k_: 5b66 K: [329389] Other proteins in same PDB: d5b66a_, d5b66b_, d5b66c_, d5b66d_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_, d5b66z_ automated match to d2axtk1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b66 (more details), 1.85 Å
SCOPe Domain Sequences for d5b66k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b66k_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d5b66k_: