Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Mangifera indica [TaxId:29780] [329180] (3 PDB entries) |
Domain d5keja2: 5kej A:85-223 [329278] Other proteins in same PDB: d5keja1, d5kejb1 automated match to d5agya2 complexed with gtx, peg |
PDB Entry: 5kej (more details), 2.35 Å
SCOPe Domain Sequences for d5keja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5keja2 a.45.1.0 (A:85-223) automated matches {Mangifera indica [TaxId: 29780]} ilpsdpydraiarfwaayldekwypslkgiasaqgeeakkaavdqvgeslaliedtyvkl skgkpffggekigyldiafgcflgwlrvtektsgvkflneaktphlakwavrfcadpavk dvmpeteklaefakllakf
Timeline for d5keja2: