Lineage for d5keja2 (5kej A:85-223)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327223Species Mangifera indica [TaxId:29780] [329180] (3 PDB entries)
  8. 2327226Domain d5keja2: 5kej A:85-223 [329278]
    Other proteins in same PDB: d5keja1, d5kejb1
    automated match to d5agya2
    complexed with gtx, peg

Details for d5keja2

PDB Entry: 5kej (more details), 2.35 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione
PDB Compounds: (A:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5keja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5keja2 a.45.1.0 (A:85-223) automated matches {Mangifera indica [TaxId: 29780]}
ilpsdpydraiarfwaayldekwypslkgiasaqgeeakkaavdqvgeslaliedtyvkl
skgkpffggekigyldiafgcflgwlrvtektsgvkflneaktphlakwavrfcadpavk
dvmpeteklaefakllakf

SCOPe Domain Coordinates for d5keja2:

Click to download the PDB-style file with coordinates for d5keja2.
(The format of our PDB-style files is described here.)

Timeline for d5keja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5keja1