Lineage for d5i4jb_ (5i4j B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317748Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries)
  8. 2317758Domain d5i4jb_: 5i4j B: [329254]
    automated match to d4cybd_
    complexed with epe, zn

Details for d5i4jb_

PDB Entry: 5i4j (more details), 2.39 Å

PDB Description: dps4 from nostoc punctiforme in complex with zn ions
PDB Compounds: (B:) Ferritin, Dps family protein

SCOPe Domain Sequences for d5i4jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4jb_ a.25.1.0 (B:) automated matches {Nostoc punctiforme [TaxId: 272131]}
tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa

SCOPe Domain Coordinates for d5i4jb_:

Click to download the PDB-style file with coordinates for d5i4jb_.
(The format of our PDB-style files is described here.)

Timeline for d5i4jb_: