Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries) |
Domain d5hnnb_: 5hnn B: [328981] Other proteins in same PDB: d5hnna2, d5hnnc2 automated match to d1gzja_ complexed with gol; mutant |
PDB Entry: 5hnn (more details), 1.63 Å
SCOPe Domain Sequences for d5hnnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hnnb_ c.1.8.0 (B:) automated matches {Xanthomonas axonopodis [TaxId: 190486]} lkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpelng pldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlalef kddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgawswrstsy gvsnakaleilkdpgnnlafeahqyldkdasgtkpvctsdsvgqerlqgftswlrenkqk gflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgsd kpqmailskyarra
Timeline for d5hnnb_:
View in 3D Domains from other chains: (mouse over for more information) d5hnna1, d5hnna2, d5hnnc1, d5hnnc2 |