Lineage for d5b7gb_ (5b7g B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2496659Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2496660Protein automated matches [190781] (45 species)
    not a true protein
  7. 2496668Species Aeromonas hydrophila [TaxId:380703] [327104] (5 PDB entries)
  8. 2496670Domain d5b7gb_: 5b7g B: [328886]
    automated match to d4qeza_
    complexed with ade, gol

Details for d5b7gb_

PDB Entry: 5b7g (more details), 1.4 Å

PDB Description: structures and functional analysis of periplasmic 5- methylthioadenosine/s-adenosylhomocysteine nucleosidase from aeromonas hydrophila
PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d5b7gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b7gb_ c.56.2.0 (B:) automated matches {Aeromonas hydrophila [TaxId: 380703]}
sapiliqgamdvevetlvaalkdkqeltvgswtywqgtlsgypvvvsrtevglanaaaat
tlamerfqprlvinqgtagghdpalhrgdivigtksfnmgayrsdltpaeqgvdpskwhn
fevtmrlrdngklvehssfagdpelvgralgmadryrhgrvvpgiigtadewnrqvarin
wlhqtyqtaaeemetssaalvaeaykvpfvgirvlsntdlhgeefdpqtaihcqqfvidy
akalingf

SCOPe Domain Coordinates for d5b7gb_:

Click to download the PDB-style file with coordinates for d5b7gb_.
(The format of our PDB-style files is described here.)

Timeline for d5b7gb_: