Lineage for d5keta_ (5ket A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2438355Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2438356Protein automated matches [190793] (30 species)
    not a true protein
  7. 2438396Species Coptotermes gestroi [TaxId:232242] [328760] (1 PDB entry)
  8. 2438397Domain d5keta_: 5ket A: [328761]
    automated match to d2fgba_
    complexed with nap

Details for d5keta_

PDB Entry: 5ket (more details), 2.85 Å

PDB Description: structure of the aldo-keto reductase from coptotermes gestroi
PDB Compounds: (A:) Aldo-keto reductase 1

SCOPe Domain Sequences for d5keta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5keta_ c.1.7.0 (A:) automated matches {Coptotermes gestroi [TaxId: 232242]}
svtfhngrkmpvvglgtwqsppeevtaaidvalevgyrhidtafmyqneaaigktlkkwf
dsgklkredvfivtklppignraesvekfltkslealqldyvdlylihlpvgfqykgddn
lwprgeageflidtstdlislwkameaqvdagrtrsvglsnfnsrqiarivksarirpan
lqvelnvyfqqrelvafcralditvcayapigspglanvikargaevpesakfdpltdpv
vlkiaehhkktpaqvllrhcmqrdivvipkstnagrikenfqvfdfelskaevdeldsld
kraagrrfrmdqykglrehpehpydepy

SCOPe Domain Coordinates for d5keta_:

Click to download the PDB-style file with coordinates for d5keta_.
(The format of our PDB-style files is described here.)

Timeline for d5keta_: