![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class pi GST [81358] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52864] (63 PDB entries) |
![]() | Domain d1aqxd2: 1aqx D:2-76 [32859] Other proteins in same PDB: d1aqxa1, d1aqxb1, d1aqxc1, d1aqxd1 complexed with gtd, mes |
PDB Entry: 1aqx (more details), 2 Å
SCOPe Domain Sequences for d1aqxd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqxd2 c.47.1.5 (D:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt lyqsntilrhlgrtl
Timeline for d1aqxd2: