SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fqoa_ (5fqo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (63 species)
    not a true protein
  7. 2130813Species Mouse (Mus musculus) [TaxId:10090] [187843] (14 PDB entries)
  8. 2285188Domain d5fqoa_: 5fqo A: [328489]
    automated match to d5egsd_
    complexed with mg, sah

Details for d5fqoa_

PDB Entry: 5fqo (more details), 1.9 Å

PDB Description: crystal structure of m. musculus protein arginine methyltransferase prmt6 with sah and magnesium
PDB Compounds: (A:) Protein arginine N-methyltransferase 6

SCOPe Domain Sequences for d5fqoa_:

Sequence, based on SEQRES records: (download)

>d5fqoa_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lyyecysdvsvheemiadqvrteayrlgilknwaalrgktvldvgagtgilsifcaqaga
rrvyaveasaiwqqarevvrlngledrvhvlpgpvetvelpervdaivsewmgygllhes
mlssvlhartkwlkegglllpasaelfvapisdqmlewrlgfwsqvkqhygvdmscmesf
atrclmghseivvqdlsgedvlarpqrfaqlelaragleqeleagvggrfrcscygsapl
hgfavwfqvtfpggdsekplvlstsplhpathwkqallylnepvpveqdtdisgeitllp
spdnprrlrillrykvgdheektkdfame

Sequence, based on observed residues (ATOM records): (download)

>d5fqoa_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lyyecysdvsvheemiadqvrteayrlgilknwaalrgktvldvgagtgilsifcaqaga
rrvyaveasaiwqqarevvrlngledrvhvlpgpvetvelpervdaivsewmgygllhes
mlssvlhartkwlkegglllpasaelfvapisdqmlewrlgfwsqvkqhygvdmscmesf
atrclmghseivvqdlsgedvlarpqrfaqlelaragleqeleagvggrfrcscygsapl
hgfavwfqvtfpgplvlstsplhpathwkqallylnepvpveqdtdisgeitllpspdnp
rrlrillrykvgdheektkdfame

SCOPe Domain Coordinates for d5fqoa_:

Click to download the PDB-style file with coordinates for d5fqoa_.
(The format of our PDB-style files is described here.)

Timeline for d5fqoa_:

  • d5fqoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18