Lineage for d5hk4c2 (5hk4 C:139-455)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447081Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2447082Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2447312Protein automated matches [226984] (16 species)
    not a true protein
  7. 2447425Species Rhodopseudomonas palustris [TaxId:1076] [327791] (7 PDB entries)
  8. 2447458Domain d5hk4c2: 5hk4 C:139-455 [328488]
    Other proteins in same PDB: d5hk4a1, d5hk4b1, d5hk4c1, d5hk4d1, d5hk4e1, d5hk4f1
    automated match to d4lf2a2
    complexed with cap, mg; mutant

Details for d5hk4c2

PDB Entry: 5hk4 (more details), 2.15 Å

PDB Description: structure function studies of r. palustris rubisco (a47v-m331a mutant)
PDB Compounds: (C:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hk4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hk4c2 c.1.14.1 (C:139-455) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwrak

SCOPe Domain Coordinates for d5hk4c2:

Click to download the PDB-style file with coordinates for d5hk4c2.
(The format of our PDB-style files is described here.)

Timeline for d5hk4c2: