SCOPe 2.07: Domain d5thoe_: 5tho E:

Lineage for d5thoe_ (5tho E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [328158] (1 PDB entry)

8. Domain d5thoe_: 5tho E: [328259]
   automated match to d2fhh1_
   complexed with 7c7

Details for d5thoe_

PDB Entry: 5tho, 3 Å

PDB Description: crystal structure of mycobacterium tuberculosis proteasome in complex with n,c-capped dipeptide inhibitor pks2205

PDB Compounds: (E:) Proteasome subunit alpha

SCOPe Domain Sequences for d5thoe_:

Sequence, based on SEQRES records:

>d5thoe_ d.153.1.4 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
ragsadtsggdqptlgvaslevavldanrprrafrritgsalqallv

Sequence, based on observed residues (ATOM records):

>d5thoe_ d.153.1.4 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
ragstlgvaslevavldanrprrafrritgsalqallv

Timeline for d5thoe_:

• d5thoe_ first appeared in SCOPe 2.06
  
• d5thoe_ appears in the current release, SCOPe 2.08