SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iy5u_ (5iy5 U:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998097Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1998098Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 1998099Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 protein domains)
  6. 1998100Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 1998101Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)
  8. 2284892Domain d5iy5u_: 5iy5 U: [328193]
    Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, hem, mg, na, pek, per, pgv, psc, tgl, unl, zn

Details for d5iy5u_

PDB Entry: 5iy5 (more details), 2 Å

PDB Description: electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5iy5u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iy5u_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5iy5u_:

Click to download the PDB-style file with coordinates for d5iy5u_.
(The format of our PDB-style files is described here.)

Timeline for d5iy5u_:

  • d5iy5u_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12