SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iy5s_ (5iy5 S:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2235033Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2235239Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2235401Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 protein domains)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 2235402Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 2235403Species Cow (Bos taurus) [TaxId:9913] [57820] (30 PDB entries)
  8. 2284813Domain d5iy5s_: 5iy5 S: [328114]
    Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_
    automated match to d1v54f_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, hem, mg, na, pek, per, pgv, psc, tgl, unl, zn

Details for d5iy5s_

PDB Entry: 5iy5 (more details), 2 Å

PDB Description: electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
PDB Compounds: (S:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d5iy5s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iy5s_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d5iy5s_:

Click to download the PDB-style file with coordinates for d5iy5s_.
(The format of our PDB-style files is described here.)

Timeline for d5iy5s_:

  • d5iy5s_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12