SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iy5w_ (5iy5 W:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2226476Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 2226477Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 protein domains)
  6. 2226478Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2226479Species Cow (Bos taurus) [TaxId:9913] [81416] (30 PDB entries)
  8. 2284770Domain d5iy5w_: 5iy5 W: [328071]
    Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5x_, d5iy5y_, d5iy5z_
    automated match to d3ag3j_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, hem, mg, na, pek, per, pgv, psc, tgl, unl, zn

Details for d5iy5w_

PDB Entry: 5iy5 (more details), 2 Å

PDB Description: electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
PDB Compounds: (W:) cytochrome c oxidase subunit 7a1, mitochondrial

SCOPe Domain Sequences for d5iy5w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iy5w_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d5iy5w_:

Click to download the PDB-style file with coordinates for d5iy5w_.
(The format of our PDB-style files is described here.)

Timeline for d5iy5w_:

  • d5iy5w_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-12