SCOP 1.65: Domain d1fvkb2: 1fvk B:1-64,B:129-188

Lineage for d1fvkb2 (1fvk B:1-64,B:129-188)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.4: Disulphide-bond formation facilitator (DSBA) [52858] (1 protein)

6. Protein Disulphide-bond formation facilitator (DSBA) [52859] (2 species)
   common fold is interrupted by a small all-alpha domain

7. Species Escherichia coli [TaxId:562] [52860] (12 PDB entries)

8. Domain d1fvkb2: 1fvk B:1-64,B:129-188 [32785]
   Other proteins in same PDB: d1fvka1, d1fvkb1

Details for d1fvkb2

PDB Entry: 1fvk, 1.7 Å

PDB Description: the 1.7 angstrom structure of wild type disulfide bond formation protein (dsba)

SCOP Domain Sequences for d1fvkb2:

Sequence; same for both SEQRES and ATOM records:

>d1fvkb2 c.47.1.4 (B:1-64,B:129-188) Disulphide-bond formation facilitator (DSBA) {Escherichia coli}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmXfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadtvk
ylsek

Timeline for d1fvkb2:

• d1fvkb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fvkb2 appears in SCOP 1.63
  
• d1fvkb2 does not appear in SCOP 1.67