Lineage for d1grxa_ (1grx A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600409Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1600417Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)
  7. 1600424Species Escherichia coli [TaxId:562] [52845] (4 PDB entries)
  8. 1600428Domain d1grxa_: 1grx A: [32766]
    complexed with gsh

Details for d1grxa_

PDB Entry: 1grx (more details)

PDB Description: structure of e. coli glutaredoxin
PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d1grxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grxa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]}
mqtvifgrsgcpysvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
qifvdqqhiggytdfaawvkenlda

SCOPe Domain Coordinates for d1grxa_:

Click to download the PDB-style file with coordinates for d1grxa_.
(The format of our PDB-style files is described here.)

Timeline for d1grxa_: