Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species) |
Species Escherichia coli [TaxId:562] [52845] (4 PDB entries) |
Domain d1grxa_: 1grx A: [32766] complexed with gsh |
PDB Entry: 1grx (more details)
SCOPe Domain Sequences for d1grxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grxa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} mqtvifgrsgcpysvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp qifvdqqhiggytdfaawvkenlda
Timeline for d1grxa_: