Lineage for d1xoa__ (1xoa -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (12 families) 
Family c.47.1.1: Thioltransferase [52834] (6 proteins) 
Protein Thioredoxin [52835] (7 species) Species Escherichia coli [TaxId:562] [52836] (9 PDB entries) 
Domain d1xoa__: 1xoa - [32731]
Details for d1xoa__
PDB Entry: 1xoa (more details)
PDB Description: thioredoxin (oxidized disulfide form), nmr, 20 structures
SCOP Domain Sequences for d1xoa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xoa__ c.47.1.1 (-) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
SCOP Domain Coordinates for d1xoa__:
Click to download the PDB-style file with coordinates for d1xoa__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xoa__:
- d1xoa__ first appeared (with stable ids) in SCOP 1.55
- d1xoa__ appears in SCOP 1.57
- d1xoa__ appears in SCOP 1.61
- d1xoa__ appears in the current release, SCOPe 2.08, called d1xoaa_
View in 3D