SCOPe 2.07: Domain d5lxyi_: 5lxy I:

Lineage for d5lxyi_ (5lxy I:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)

8. Domain d5lxyi_: 5lxy I: [327209]
   automated match to d3ulha_
   protein/RNA complex; complexed with br

Details for d5lxyi_

PDB Entry: 5lxy, 2.85 Å

PDB Description: structure of the minimal rbm7 - zcchc8 complex

PDB Compounds: (I:) RNA-binding protein 7

SCOPe Domain Sequences for d5lxyi_:

Sequence, based on SEQRES records:

>d5lxyi_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpya
mnllngiklygrpikiqfrs

Sequence, based on observed residues (ATOM records):

>d5lxyi_ d.58.7.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadrtfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfafvnfkhevsvpyam
nllngiklygrpikiqfrs

Timeline for d5lxyi_:

• d5lxyi_ first appeared in SCOPe 2.06
  
• d5lxyi_ appears in the current release, SCOPe 2.08