Lineage for d5gtua_ (5gtu A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206306Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2206307Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2206544Family d.159.1.7: YfcE-like [111233] (5 protein domains)
  6. 2206581Protein automated matches [254477] (2 species)
    not a true protein
  7. 2283627Species Homo sapiens [TaxId:9606] [326928] (1 PDB entry)
  8. 2283628Domain d5gtua_: 5gtu A: [326929]
    automated match to d2r17a_

Details for d5gtua_

PDB Entry: 5gtu (more details), 1.5 Å

PDB Description: structural and mechanistic insights into regulation of the retromer coat by tbc1d5
PDB Compounds: (A:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d5gtua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtua_ d.159.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]}
maghrlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdv
hivrgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisght
hkfeafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkver
ieykkp

SCOPe Domain Coordinates for d5gtua_:

Click to download the PDB-style file with coordinates for d5gtua_.
(The format of our PDB-style files is described here.)

Timeline for d5gtua_:

  • d5gtua_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08