SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gtua_ (5gtu A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206306Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2206307Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2206544Family d.159.1.7: YfcE-like [111233] (5 protein domains)
  6. 2206581Protein automated matches [254477] (2 species)
    not a true protein
  7. 2283627Species Homo sapiens [TaxId:9606] [326928] (1 PDB entry)
  8. 2283628Domain d5gtua_: 5gtu A: [326929]
    automated match to d2r17a_

Details for d5gtua_

PDB Entry: 5gtu (more details), 1.5 Å

PDB Description: structural and mechanistic insights into regulation of the retromer coat by tbc1d5
PDB Compounds: (A:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d5gtua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtua_ d.159.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]}
maghrlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdv
hivrgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisght
hkfeafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkver
ieykkp

SCOPe Domain Coordinates for d5gtua_:

Click to download the PDB-style file with coordinates for d5gtua_.
(The format of our PDB-style files is described here.)

Timeline for d5gtua_:

  • d5gtua_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08