SCOPe 2.07: Domain d5ep8a1: 5ep8 A:1-70

Lineage for d5ep8a1 (5ep8 A:1-70)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.0: automated matches [254276] (1 protein)
   not a true family

6. Protein automated matches [254641] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [326391] (2 PDB entries)

8. Domain d5ep8a1: 5ep8 A:1-70 [326392]
   Other proteins in same PDB: d5ep8a2, d5ep8a3, d5ep8b2, d5ep8b3
   automated match to d3h5qa1
   complexed with na, so4

Details for d5ep8a1

PDB Entry: 5ep8, 2.66 Å

PDB Description: x-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis with sulfate ion

PDB Compounds: (A:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d5ep8a1:

Sequence; same for both SEQRES and ATOM records:

>d5ep8a1 a.46.2.0 (A:1-70) automated matches {Bacillus subtilis [TaxId: 224308]}
mrmvdiiikkqngkeltteeiqffvngytdgsipdyqasalamaiffrdmsdreradltm
amvnsgetid

Timeline for d5ep8a1:

• d5ep8a1 first appeared in SCOPe 2.06
  
• d5ep8a1 appears in the current release, SCOPe 2.08