![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
![]() | Family a.46.2.0: automated matches [254276] (1 protein) not a true family |
![]() | Protein automated matches [254641] (5 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [326391] (2 PDB entries) |
![]() | Domain d5ep8a1: 5ep8 A:1-70 [326392] Other proteins in same PDB: d5ep8a2, d5ep8a3, d5ep8b2, d5ep8b3 automated match to d3h5qa1 complexed with na, so4 |
PDB Entry: 5ep8 (more details), 2.66 Å
SCOPe Domain Sequences for d5ep8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ep8a1 a.46.2.0 (A:1-70) automated matches {Bacillus subtilis [TaxId: 224308]} mrmvdiiikkqngkeltteeiqffvngytdgsipdyqasalamaiffrdmsdreradltm amvnsgetid
Timeline for d5ep8a1: