Lineage for d5tk8a_ (5tk8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350180Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2350181Protein automated matches [190983] (10 species)
    not a true protein
  7. 2350182Species Bacillus megaterium [TaxId:1404] [326307] (5 PDB entries)
  8. 2350183Domain d5tk8a_: 5tk8 A: [326324]
    automated match to d2paua_
    complexed with 7d5, mg

Details for d5tk8a_

PDB Entry: 5tk8 (more details), 1.64 Å

PDB Description: structure of the hd-domain phosphohydrolase oxsa with oxetanocin-a monophosphate bound
PDB Compounds: (A:) OxsA protein

SCOPe Domain Sequences for d5tk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tk8a_ a.211.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
sslldiiyqlrqvprwdgsfqfekedvsqhsfsviaishilcelketlegkkinkeklll
yalyhdvtevvsthiispvkknsilkdpfnafreqiknslfdnlpitlsdtlstilnnnd
leiqeivehadhvdayckscievhrgnkdfisiqrslgdkldnltkeypylkefqnlflk
dfplenknyry

SCOPe Domain Coordinates for d5tk8a_:

Click to download the PDB-style file with coordinates for d5tk8a_.
(The format of our PDB-style files is described here.)

Timeline for d5tk8a_: