Lineage for d5jpca_ (5jpc A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2496659Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2496660Protein automated matches [190781] (45 species)
    not a true protein
  7. 2496932Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries)
  8. 2496953Domain d5jpca_: 5jpc A: [326261]
    automated match to d4p54a_
    complexed with dod, fmc

Details for d5jpca_

PDB Entry: 5jpc (more details), 2.5 Å

PDB Description: joint x-ray/neutron structure of mtan complex with formycin a
PDB Compounds: (A:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d5jpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpca_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

SCOPe Domain Coordinates for d5jpca_:

Click to download the PDB-style file with coordinates for d5jpca_.
(The format of our PDB-style files is described here.)

Timeline for d5jpca_: