SCOPe 2.03: Domain d1nocb_: 1noc B:

Lineage for d1nocb_ (1noc B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.1: CAT-like [52778] (3 proteins)
   trimeric enzymes with the active sites being located in between subunits

6. Protein Chloramphenicol acetyltransferase, CAT [52779] (2 species)

7. Species Escherichia coli [TaxId:562] [52780] (9 PDB entries)
   Uniprot P00483

8. Domain d1nocb_: 1noc B: [32615]
   Other proteins in same PDB: d1noca_
   complexed with hem, imd

Details for d1nocb_

PDB Entry: 1noc, 2.6 Å

PDB Description: murine inducible nitric oxide synthase oxygenase domain (delta 114) complexed with type i e. coli chloramphenicol acetyl transferase and imidazole

PDB Compounds: (B:) type 1 chloramphenicol acetyltransferase

SCOPe Domain Sequences for d1nocb_:

Sequence; same for both SEQRES and ATOM records:

>d1nocb_ c.43.1.1 (B:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]}
itgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihila
rlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdv
acygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvl
mplaiqvhhavcdgfhvgrmlnelqqycdewqg

Timeline for d1nocb_:

• d1nocb_ first appeared (with stable ids) in SCOP 1.55
  
• d1nocb_ appears in SCOPe 2.02
  
• d1nocb_ appears in SCOPe 2.04
  
• d1nocb_ appears in the current release, SCOPe 2.08