Lineage for d5lttc_ (5ltt C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201124Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2201125Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2205325Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2205326Protein automated matches [190509] (14 species)
    not a true protein
  7. 2205369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2282759Domain d5lttc_: 5ltt C: [326060]
    Other proteins in same PDB: d5ltta_, d5lttb_, d5lttf_, d5lttg_, d5ltth_, d5ltti_, d5lttj_, d5lttk_, d5lttl_, d5lttm_, d5lttn_, d5ltto_, d5lttp_, d5lttt_, d5lttu_, d5lttv_, d5lttw_, d5lttx_, d5ltty_, d5lttz_
    automated match to d1iruf_
    complexed with 39v, cl, mes, mg

Details for d5lttc_

PDB Entry: 5ltt (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; r57t)in complex with pr-924
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5lttc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lttc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5lttc_:

Click to download the PDB-style file with coordinates for d5lttc_.
(The format of our PDB-style files is described here.)

Timeline for d5lttc_:

  • d5lttc_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-13