SCOPe 2.07: Domain d5l6ak_: 5l6a K:

Lineage for d5l6ak_ (5l6a K:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d5l6ak_: 5l6a K: [325995]
   Other proteins in same PDB: d5l6aa_, d5l6ab_, d5l6ac_, d5l6ad_, d5l6ae_, d5l6af_, d5l6ah_, d5l6ai_, d5l6aj_, d5l6am_, d5l6an_, d5l6ao_, d5l6ap_, d5l6aq_, d5l6ar_, d5l6as_, d5l6at_, d5l6av_, d5l6aw_, d5l6ax_
   automated match to d5cgfk_
   complexed with 79l, cl, mes, mg

Details for d5l6ak_

PDB Entry: 5l6a, 2.8 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 17

PDB Compounds: (K:) Proteasome subunit beta type-8,Proteasome subunit beta type-5

SCOPe Domain Sequences for d5l6ak_:

Sequence; same for both SEQRES and ATOM records:

>d5l6ak_ d.153.1.4 (K:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafkfqhgvivavdsratagsyisslrmnkvieinpyllgtmsgcaadcqywerlla
kecrlyylrngerisvsaaskllsnmmlqyrgmglsmgsmicgwdkkgpglyyvddngtr
lsgqmfstgsgntyaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhvt
edgwiyhgnhdvgelfwkvkeeegsfnnvig

Timeline for d5l6ak_:

• d5l6ak_ first appeared in SCOPe 2.06
  
• d5l6ak_ appears in the current release, SCOPe 2.08