SCOPe 2.07: Domain d5l5qv_: 5l5q V:

Lineage for d5l5qv_ (5l5q V:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d5l5qv_: 5l5q V: [325282]
   Other proteins in same PDB: d5l5qa_, d5l5qc_, d5l5qd_, d5l5qe_, d5l5qg_, d5l5qi_, d5l5qj_, d5l5qk_, d5l5ql_, d5l5qn_, d5l5qo_, d5l5qq_, d5l5qr_, d5l5qs_, d5l5qu_, d5l5qw_, d5l5qx_, d5l5qy_, d5l5qz_
   automated match to d4r17h_
   complexed with 6nv, cl, mes, mg

Details for d5l5qv_

PDB Entry: 5l5q, 2.8 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone 18

PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l5qv_:

Sequence; same for both SEQRES and ATOM records:

>d5l5qv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

Timeline for d5l5qv_:

• d5l5qv_ first appeared in SCOPe 2.06
  
• d5l5qv_ appears in the current release, SCOPe 2.08