Lineage for d5fula_ (5ful A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894879Species Mouse (Mus musculus) [TaxId:10090] [187843] (21 PDB entries)
  8. 2894902Domain d5fula_: 5ful A: [324865]
    automated match to d2fyta1
    complexed with ca, cl, edo, pg4, sah

Details for d5fula_

PDB Entry: 5ful (more details), 1.89 Å

PDB Description: crystal structure of mus musculus protein arginine methyltransferase 2 with sah
PDB Compounds: (A:) Protein arginine N-methyltransferase 2

SCOPe Domain Sequences for d5fula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fula_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtwqdeeyfdsygtlklhlemladqprttkyhsvilqnkeslkdkvildvgcgtgiislf
cahharpkavyaveasdmaqhtsqlvlqngfadtitvfqqkvedvvlpekvdvlvsewmg
tcllfefmiesilyardtwlkgdgiiwpttaalhlvpcsaekdyhskvlfwdnayefnls
alkslaikeffsrpksnhilkpedclsepctilqldmrtvqvpdletmrgelrfdiqkag
tlhgftawfsvyfqsleegqpqqvlstgplhptthwkqtlfmmddpvpvhtgdvvtgsvv
lqrnpvwrrhmsvslswvvtsaldptsqrvgekvfpiww

SCOPe Domain Coordinates for d5fula_:

Click to download the PDB-style file with coordinates for d5fula_.
(The format of our PDB-style files is described here.)

Timeline for d5fula_: