![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class pi GST [81347] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries) |
![]() | Domain d5djma2: 5djm A:79-209 [324820] Other proteins in same PDB: d5djma1, d5djmb1 automated match to d1gssa1 complexed with mes, pt |
PDB Entry: 5djm (more details), 1.9 Å
SCOPe Domain Sequences for d5djma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5djma2 a.45.1.1 (A:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} ygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnqg gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey vnlpingngkq
Timeline for d5djma2: