Lineage for d5jy3b_ (5jy3 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728875Protein Oxysterols receptor LXR-beta [89149] (1 species)
  7. 2728876Species Human (Homo sapiens) [TaxId:9606] [89150] (21 PDB entries)
    Uniprot P55055 219-461
  8. 2728909Domain d5jy3b_: 5jy3 B: [324791]
    automated match to d1p8da_
    complexed with 6ox, bu1

Details for d5jy3b_

PDB Entry: 5jy3 (more details), 2.4 Å

PDB Description: crystal structure of lxrbeta (nuclear receptor subfamily 1, group h, member 2) complexed with bms-852927
PDB Compounds: (B:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d5jy3b_:

Sequence, based on SEQRES records: (download)

>d5jy3b_ a.123.1.1 (B:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaiis
vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskd
dfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqp
yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

Sequence, based on observed residues (ATOM records): (download)

>d5jy3b_ a.123.1.1 (B:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfpkvtpwprdarqqrfahftelaiisvqeivdfakq
vpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglqve
finpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytr
ikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

SCOPe Domain Coordinates for d5jy3b_:

Click to download the PDB-style file with coordinates for d5jy3b_.
(The format of our PDB-style files is described here.)

Timeline for d5jy3b_: