Lineage for d5ecoc1 (5eco C:4-83)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.0: automated matches [191312] (1 protein)
not a true familyProtein automated matches [190056] (188 species)
not a true protein
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries) 
Domain d5ecoc1: 5eco C:4-83 [324730]
Other proteins in same PDB: d5ecob2, d5ecoc2, d5ecoe2, d5ecof2
automated match to d3fhsa3
complexed with gsh, jaa, leu, mg
Details for d5ecoc1
PDB Entry: 5eco (more details), 1.8 Å
PDB Description: crystal structure of fin219-fip1 complex with ja, leu and mg
PDB Compounds: (C:) Glutathione S-transferase U20SCOPe Domain Sequences for d5ecoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ecoc1 c.47.1.0 (C:4-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lpilldywpsmfgmrarvalrekgvefeyreedfsnksplllqsnpihkkipvlvhngkp
vceslnvvqyvdeawpeknp
SCOPe Domain Coordinates for d5ecoc1:
Click to download the PDB-style file with coordinates for d5ecoc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ecoc1:
View in 3D
