Lineage for d5hoca_ (5hoc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328122Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2328123Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2328184Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 2328185Protein automated matches [259190] (2 species)
    not a true protein
  7. 2328186Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries)
  8. 2328195Domain d5hoca_: 5hoc A: [324192]
    automated match to d3zy1a_
    mutant

Details for d5hoca_

PDB Entry: 5hoc (more details), 1.36 Å

PDB Description: p73 homo-tetramerization domain mutant ii
PDB Compounds: (A:) Tumor protein p73

SCOPe Domain Sequences for d5hoca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hoca_ a.53.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tyylqvrgrrnfeilmelkrslelmelvpqplvdsydqqqqllq

SCOPe Domain Coordinates for d5hoca_:

Click to download the PDB-style file with coordinates for d5hoca_.
(The format of our PDB-style files is described here.)

Timeline for d5hoca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5hocb_