Lineage for d1fuub1 (1fuu B:11-225)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 244087Family c.37.1.19: Tandem AAA-ATPase domain [81268] (6 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 244106Protein Initiation factor 4a [52706] (1 species)
    homologous to UvrB
  7. 244107Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52707] (4 PDB entries)
  8. 244112Domain d1fuub1: 1fuu B:11-225 [32413]

Details for d1fuub1

PDB Entry: 1fuu (more details), 2.5 Å

PDB Description: yeast initiation factor 4a

SCOP Domain Sequences for d1fuub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuub1 c.37.1.19 (B:11-225) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae)}
qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
ppttqvvllsatmpndvlevttkfmrnpvrilvkk

SCOP Domain Coordinates for d1fuub1:

Click to download the PDB-style file with coordinates for d1fuub1.
(The format of our PDB-style files is described here.)

Timeline for d1fuub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fuub2
View in 3D
Domains from other chains:
(mouse over for more information)
d1fuua_