SCOPe 2.07: Domain d5lxbc_: 5lxb C:

Lineage for d5lxbc_ (5lxb C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5lxbc_: 5lxb C: [324014]
   automated match to d2w8gc_
   complexed with 7a9, nag; mutant

Details for d5lxbc_

PDB Entry: 5lxb, 2.34 Å

PDB Description: crystal structure of a mutant binding protein (5htbp-achbp) in complex with palonosetron

PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5lxbc_:

Sequence; same for both SEQRES and ATOM records:

>d5lxbc_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvywerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

Timeline for d5lxbc_:

• d5lxbc_ first appeared in SCOPe 2.06
  
• d5lxbc_ appears in the current release, SCOPe 2.08