SCOPe 2.07: Domain d2pjrf1: 2pjr F:704-1018

Lineage for d2pjrf1 (2pjr F:704-1018)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein DEXX box DNA helicase [52701] (2 species)
   each AAA domain contains an all-alpha insert subdomain

7. Species Bacillus stearothermophilus, PcrA [TaxId:1422] [52702] (5 PDB entries)

8. Domain d2pjrf1: 2pjr F:704-1018 [32397]
   protein/DNA complex; complexed with so4

Details for d2pjrf1

PDB Entry: 2pjr, 2.9 Å

PDB Description: helicase product complex

PDB Compounds: (F:) protein (helicase pcra)

SCOPe Domain Sequences for d2pjrf1:

Sequence; same for both SEQRES and ATOM records:

>d2pjrf1 c.37.1.19 (F:704-1018) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}
lseqllahlnkeqqeavrttegpllimagagsgktrvlthriaylmaekhvapwnilait
ftnkaaremrervqsllggaaedvwistfhsmcvrilrrdidriginrnfsildptdqls
vmktilkeknidpkkfeprtilgtisaaknellppeqfakrastyyekvvsdvyqeyqqr
llrnhsldfddlimttiqlfdrvpdvlhyyqykfqyihideyqdtnraqytlvkklaerf
qnicavgdadqsiyrwrgadiqnilsferdypnakvilleqnyrstkrilqaaneviehn
vnrkpkriwtenpeg

Timeline for d2pjrf1:

• d2pjrf1 first appeared (with stable ids) in SCOP 1.55
  
• d2pjrf1 appears in SCOPe 2.06
  
• d2pjrf1 appears in the current release, SCOPe 2.08