![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) multihelical |
![]() | Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) ![]() duplication: contains two structural repeats |
![]() | Family a.86.1.0: automated matches [254307] (1 protein) not a true family |
![]() | Protein automated matches [254708] (4 species) not a true protein |
![]() | Species Bacillus megaterium [TaxId:1404] [255981] (21 PDB entries) |
![]() | Domain d5i3aa_: 5i3a A: [323922] automated match to d4p6ra_ complexed with hqe, zn |
PDB Entry: 5i3a (more details), 2.2 Å
SCOPe Domain Sequences for d5i3aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i3aa_ a.86.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]} kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
Timeline for d5i3aa_: