SCOPe 2.07: Domain d5el9a2: 5el9 A:96-207

Lineage for d5el9a2 (5el9 A:96-207)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
   duplication; there are two structural repeats of this fold

6. Protein automated matches [254526] (2 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries)

8. Domain d5el9a2: 5el9 A:96-207 [323601]
   Other proteins in same PDB: d5el9a1
   automated match to d4mu3a2
   complexed with 5dl, edo, mn, trs

Details for d5el9a2

PDB Entry: 5el9, 1.1 Å

PDB Description: a. thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution

PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d5el9a2:

Sequence; same for both SEQRES and ATOM records:

>d5el9a2 d.14.1.9 (A:96-207) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprrggtipsskgvlsrs

Timeline for d5el9a2:

• d5el9a2 first appeared in SCOPe 2.06
  
• d5el9a2 appears in the current release, SCOPe 2.08