Lineage for d1n2ch_ (1n2c H:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins) 
Protein Nitrogenase iron protein [52661] (2 species) 
Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries) 
Domain d1n2ch_: 1n2c H: [32262]
Other proteins in same PDB: d1n2ca_, d1n2cb_, d1n2cc_, d1n2cd_
Details for d1n2ch_
PDB Entry: 1n2c (more details), 3 Å
PDB Description: nitrogenase complex from azotobacter vinelandii stabilized by adp- tetrafluoroaluminate
SCOP Domain Sequences for d1n2ch_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n2ch_ c.37.1.10 (H:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgim
SCOP Domain Coordinates for d1n2ch_:
Click to download the PDB-style file with coordinates for d1n2ch_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n2ch_:
- d1n2ch_ appears in SCOP 1.57
- d1n2ch_ appears in the current release, SCOPe 2.08
View in 3D
