SCOP 1.65: Domain d1n2ce_: 1n2c E:

Lineage for d1n2ce_ (1n2c E:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (11 PDB entries)

8. Domain d1n2ce_: 1n2c E: [32259]
   Other proteins in same PDB: d1n2ca_, d1n2cb_, d1n2cc_, d1n2cd_

Details for d1n2ce_

PDB Entry: 1n2c, 3 Å

PDB Description: nitrogenase complex from azotobacter vinelandii stabilized by adp- tetrafluoroaluminate

SCOP Domain Sequences for d1n2ce_:

Sequence; same for both SEQRES and ATOM records:

>d1n2ce_ c.37.1.10 (E:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgim

Timeline for d1n2ce_:

• d1n2ce_ first appeared (with stable ids) in SCOP 1.55
  
• d1n2ce_ appears in SCOP 1.63
  
• d1n2ce_ appears in SCOP 1.67
  
• d1n2ce_ appears in the current release, SCOPe 2.08