SCOPe 2.07: Domain d5hapa_: 5hap A:

Lineage for d5hapa_ (5hap A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d5hapa_: 5hap A: [322185]
   automated match to d4s2pa_
   complexed with 1pe, cl, edo, mpd, na, peg, pg4, pge; mutant

Details for d5hapa_

PDB Entry: 5hap, 1.89 Å

PDB Description: oxa-48 beta-lactamase - s70a mutant

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5hapa_:

Sequence; same for both SEQRES and ATOM records:

>d5hapa_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpaatfkipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii
p

Timeline for d5hapa_:

• d5hapa_ first appeared in SCOPe 2.06
  
• d5hapa_ appears in the current release, SCOPe 2.08