Lineage for d1b23p3 (1b23 P:1-212)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179540Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 179557Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries)
  8. 179558Domain d1b23p3: 1b23 P:1-212 [32124]
    Other proteins in same PDB: d1b23p1, d1b23p2

Details for d1b23p3

PDB Entry: 1b23 (more details), 2.6 Å

PDB Description: e. coli cysteinyl-trna and t. aquaticus elongation factor ef-tu:gtp ternary complex

SCOP Domain Sequences for d1b23p3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b23p3 c.37.1.8 (P:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus}
akgefirtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt

SCOP Domain Coordinates for d1b23p3:

Click to download the PDB-style file with coordinates for d1b23p3.
(The format of our PDB-style files is described here.)

Timeline for d1b23p3: