Lineage for d5hglf1 (5hgl F:1-147)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330931Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2330932Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2330933Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2330972Protein HIV-1 capsid protein [47945] (1 species)
  7. 2330973Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2331107Domain d5hglf1: 5hgl F:1-147 [321017]
    Other proteins in same PDB: d5hgla2, d5hglb2, d5hglc2, d5hgld2, d5hgle2, d5hglf2
    automated match to d4xfxa1
    complexed with 1b0, cl

Details for d5hglf1

PDB Entry: 5hgl (more details), 3.1 Å

PDB Description: hexameric hiv-1 ca, open conformation
PDB Compounds: (F:) capsid protein p24

SCOPe Domain Sequences for d5hglf1:

Sequence, based on SEQRES records: (download)

>d5hglf1 a.73.1.1 (F:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d5hglf1 a.73.1.1 (F:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpreprgsdiagttstlqeqigwmthnppipvgeiyk
rwiilglnkivrmysp

SCOPe Domain Coordinates for d5hglf1:

Click to download the PDB-style file with coordinates for d5hglf1.
(The format of our PDB-style files is described here.)

Timeline for d5hglf1: