Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries) Uniprot P04896 39-388 |
Domain d1cs4c2: 1cs4 C:39-65,C:202-388 [32088] Other proteins in same PDB: d1cs4a_, d1cs4b_, d1cs4c1 complexed with 101, cl, fok, gsp, mes, mg, pop |
PDB Entry: 1cs4 (more details), 2.5 Å
SCOPe Domain Sequences for d1cs4c2:
Sequence, based on SEQRES records: (download)
>d1cs4c2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg dgrhycyphftcavdtenirrvfndcrdiiqrmhl
>d1cs4c2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg dgrhycyphftcavdtenirrvfndcrdiiqrml
Timeline for d1cs4c2: